Metabolic & GLP-1PeptideEvidence B2 cited

Cagrilintide

Long-Acting Amylin Analog

aka NN9838 · AM833 · amylin analogue

A long-acting amylin analog researched for satiety promotion and enhanced weight loss, particularly alongside semaglutide.

Molecular wt
4409g/mol
Formula
C194H312N54O59S2
CAS
1415456-99-3
Half-life
7 days
clinical
Tmax
1 day

Sequence

One-letter37 residues

KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2

Three-letter

Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Glu-Phe-Leu-Arg-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Pro-NH2

Read this before quoting the sequence
37-residue C-terminally amidated amylin analogue with an intramolecular disulfide between Cys2 and Cys7, and a C20 diacid (19-carboxy-1-oxononadecyl) acyl chain attached via a gamma-glutamyl linker to Lys1. Sequence and modifications taken from the systematic CAS-style name on the PubChem record; PubChem numbers the disulfide as 3->8 because it counts the gamma-Glu linker as residue 1.
Source ↗

Mechanism of action

Cagrilintide is an acylated analog of amylin, a hormone co-secreted with insulin by pancreatic beta cells. It binds to amylin receptors in the brain, particularly in the area postrema and nucleus tractus solitarius, to promote feelings of fullness and reduce food intake. Additionally, it slows gastric emptying, which prolongs the sensation of satiety and helps regulate blood glucose levels.

What the evidence actually shows

Grade B

There are several Phase III human trials that demonstrate cagrilintide's efficacy in promoting weight loss and enhancing the effects of semaglutide. These studies show significant reductions in body weight and improvements in glycemic control. However, long-term safety data and studies on diverse populations are still needed.

Regulatory status

Status
Investigational; not approved in any jurisdiction. Developed by Novo Nordisk, principally as the fixed combination with semaglutide (CagriSema).
Clinical stage
Phase 3. Registered phase 3 studies include NCT05567796 (REDEFINE, active not recruiting), NCT06323174 (completed), NCT06221969 (completed, vs tirzepatide) and NCT07220759 (active not recruiting).
UK
research_compound

Cagrilintide is currently under investigation in the UK and is not yet approved for general medical use. It is considered an emerging treatment for obesity.

Source ↗

Pharmacokinetics

Half-life
7 days
Tmax
1 day
Absorption
subcutaneous
Elimination
renal
Washout
35 days
Titration
Dose escalation
Low-confidence pharmacokinetics
These figures are recorded as clinical rather than measured in a published PK study. Treat them as an order of magnitude. Anything downstream of them — accumulation, steady state, washout — inherits that uncertainty.

Dosing — what backs each figure

Cagrilintide is a Novo Nordisk investigational long-acting amylin analogue with well-documented trial regimens: subcutaneous once weekly, titrated over 6-16 weeks from 0.16-0.3 mg up to 2.4 or 4.5 mg, and maintained continuously for 20-26 weeks or longer, including in combination with semaglutide 2.4 mg (CagriSema, now in phase 3). It has no marketing approval. Titration is not optional — every trial escalated gradually, and no trial used cycling or planned breaks.

ClinicalApproved labelling or a published human trial
  • Subcutaneous self-injection once weekly at 0.3, 0.6, 1.2, 2.4 or 4.5 mg, over a 26-week treatment period including a dose-escalation period of up to 6 weeks, then 6 weeks follow-up off treatment; comparators were once-daily liraglutide 3.0 mg and placebo

    Adults without diabetes, BMI >= 30, or >= 27 with hypertension or dyslipidaemia; 57 sites in 10 countries · subcutaneous

    Dose-finding phase 2 trial, The Lancet 2021

  • Once-weekly subcutaneous cagrilintide 0.16, 0.30, 0.60, 1.2, 2.4 or 4.5 mg co-administered with once-weekly subcutaneous semaglutide 2.4 mg; both co-escalated at 4-week intervals to target dose over 16 weeks, then 4 weeks at target dose, then 5 weeks follow-up

    Otherwise healthy individuals aged 18-55 with BMI 27.0-39.9 kg/m2 · subcutaneous

    Randomised multiple-ascending-dose phase 1b trial, The Lancet 2021

  • Cagrilintide 2.4 mg once weekly co-administered with semaglutide 2.4 mg once weekly (CagriSema)

    Adults with type 2 diabetes · subcutaneous

    Multicentre randomised double-blind active-controlled phase 2 trial, The Lancet 2023

Handling and storage

No compound-specific stability data exists
Cagrilintide is an unapproved investigational product; no public label, SmPC or published stability study exists. It does contain a Cys2-Cys7 disulfide (verified from the PubChem structure), which is chemically relevant, but no measured storage or freeze-thaw data was found. No compound-specific stability study (lyophilised or reconstituted) was located in a primary/regulatory source during this verification pass. Only generic synthetic-peptide handling guidance exists for this compound; no specific temperatures or durations are recorded here rather than fabricating them. General peptide handling still applies — reconstitute gently, keep it cold, keep it dark — but any specific figure you see quoted for this compound elsewhere is someone's assumption, not a measurement.

Safety

Commonly reported
  • ·Nausea
  • ·Vomiting
  • ·Diarrhea
Rarely reported
  • ·Pancreatitis
  • ·"Severe hypoglycemia when used with insulin"
Contraindications
  • ·Severe gastrointestinal disease
  • ·History of pancreatitis
  • ·Pregnancy
Drug interactions
  • ·GLP-1 receptor agonists: Enhanced weight loss effects due to complementary mechanisms

Nausea, injection-site reactions

Reported combinations

Reported as synergistic
  • ·Semaglutide
Reported as antagonistic
  • ·Prokinetic agents: May counteract the gastric emptying delay

Combination claims in this dataset are largely unsourced and should be treated as folk knowledge until a citation appears beside them.

References (2)

Data provenance

Chemistry and citations on this page were checked against primary sources on 2026-08-14. Values that could not be verified were left blank rather than filled with a plausible guess.

Could not verify
storage.lyophilized, storage.reconstituted, storage.lightSensitive, reconstitution.solvent, regulatory.wada

Research use only
This profile is educational reference material. It is not medical advice, not a prescription, and not an endorsement of self-administration. Compounds discussed here are research chemicals and most are not approved for human therapeutic use.