Growth & GHPeptideEvidence B4 cited

CJC-1295 (with DAC)

Drug Affinity Complex GHRH Analog

aka DAC:GRF · Drug Affinity Complex GRF

A long-acting GHRH analogue research describes as sustaining elevated GH levels for up to eight days per dose.

Molecular wt
3647.2g/mol
Formula
C165H269N47O46
CAS
446262-90-4
Half-life
8 days
clinical
Tmax
1 day
Route
Subcutaneous injection

Sequence

One-letter30 residues

YADAIFTQSYRKVLAQLSARKLLQDILSRK

Three-letter

L-Tyr-D-Ala-L-Asp-L-Ala-L-Ile-L-Phe-L-Thr-L-Gln-L-Ser-L-Tyr-L-Arg-L-Lys-L-Val-L-Leu-L-Ala-L-Gln-L-Leu-L-Ser-L-Ala-L-Arg-L-Lys-L-Leu-L-Leu-L-Gln-L-Asp-L-Ile-L-Leu-L-Ser-L-Arg-L-Lys-NH2

Read this before quoting the sequence
30-residue analogue of human GRF(1-29) with four substitutions and a C-terminal Lys30 amide bearing an N6-[3-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)propanoyl] (maleimidopropionyl) group - the 'Drug Affinity Complex' (DAC) that forms a covalent bond to albumin Cys34. The one-letter string cannot represent the D-Ala at position 2 or the maleimide; residue 2 is D-alanine. PubChem CID 91971820 IUPAC name confirms the terminal '1-amino-6-[3-(2,5-dioxopyrrol-1-yl)propanoylamino]-1-oxohexan-2-yl' residue.
Source ↗

Mechanism of action

CJC-1295 with DAC is a synthetic peptide that stimulates the pituitary gland to release growth hormone (GH). It binds to the growth hormone-releasing hormone (GHRH) receptors, leading to increased GH secretion. The Drug Affinity Complex (DAC) extends its half-life, allowing for sustained GH elevation over several days.

What the evidence actually shows

Grade B

There are a few human trials that have demonstrated CJC-1295's ability to increase growth hormone levels and improve body composition. However, long-term safety and efficacy data are lacking, and more comprehensive studies are needed.

Regulatory status

Status
Not approved as a medicine in any jurisdiction identified. No entry in Drugs@FDA or the EMA medicines register.
Clinical stage
Phase 1/2 studies in healthy adults published 2006-2009 (Teichman 2006, Ionescu 2006). No later-stage or ongoing registered development identified.
WADA
Prohibited at all times. WADA 2026 Prohibited List S2.2.4 names 'growth hormone-releasing hormone (GHRH) and its analogues (e.g. CJC-1293, CJC-1295, sermorelin and tesamorelin)'.
UK
research_compound

In the UK, CJC-1295 is not approved for medical use and is considered a research compound.

Source ↗

Pharmacokinetics

Half-life
8 days
Tmax
1 day
Absorption
subcutaneous
Elimination
renal
Washout
14 days
Low-confidence pharmacokinetics
These figures are recorded as clinical rather than measured in a published PK study. Treat them as an order of magnitude. Anything downstream of them — accumulation, steady state, washout — inherits that uncertainty.

Dosing — what backs each figure

CJC-1295 with DAC (the albumin-binding drug-affinity-complex GHRH analogue used by ConjuChem) does have real published human data: phase 1 subcutaneous single ascending doses and 2-3 weekly or biweekly doses in healthy adults, plus single 60 or 90 microg/kg injections in healthy men, with a plasma half-life of 5.8-8.1 days. It has never been approved anywhere, development was discontinued, and no maintenance or 'cycle' regimen has ever been established.

ClinicalApproved labelling or a published human trial
Commonly circulatedNot established by any study
Dose
Research literature cites ~1 to 2 mg weekly
Frequency
Once weekly
Cycle
8-12 weeks· unsourced

Why this isn't evidence
Every published human CJC-1295 dose is weight-based in microg/kg (30-90 microg/kg, i.e. roughly 2-6 mg for a 70 kg adult), not a flat 1-2 mg, and no trial ran an '8-12 week' course - the two phase 1 studies lasted 28 and 49 days and the only registered longer study (NCT00267527, 12 weeks in HIV visceral obesity) was terminated without published dose data.

This figure is shown because it is what circulates and what people search for — not because it is supported. Cycle lengths in particular tend to be convention copied between compounds rather than anything derived from a compound's own pharmacokinetics.

Handling and storage

No compound-specific stability data exists
No compound-specific storage data could be retrieved from any regulatory label, pharmacopoeia or peer-reviewed stability study. CJC-1295 has no marketing authorisation anywhere, so no approved-product storage specification exists. Only generic lyophilised-peptide handling guidance exists, and no source was found that states specific temperatures or durations for this compound. General peptide handling still applies — reconstitute gently, keep it cold, keep it dark — but any specific figure you see quoted for this compound elsewhere is someone's assumption, not a measurement.

Safety

Commonly reported
  • ·Injection site reactions
  • ·Water retention
  • ·Joint pain
Rarely reported
  • ·Carpal tunnel syndrome
  • ·Increased risk of diabetes
Contraindications
  • ·Active cancer
  • ·Uncontrolled diabetes
  • ·Pregnancy
Drug interactions
  • ·Insulin: May enhance hypoglycemic effects due to increased GH levels

Water retention, headache, injection-site reactions

Reported combinations

Reported as synergistic
  • ·GHRP-6: May enhance GH release when used together
Reported as antagonistic
  • ·Somatostatin analogs: May inhibit GH release

Combination claims in this dataset are largely unsourced and should be treated as folk knowledge until a citation appears beside them.

References (4)

Data provenance

Chemistry and citations on this page were checked against primary sources on 2026-08-14. Values that could not be verified were left blank rather than filled with a plausible guess.

Could not verify
storage, reconstitution

Research use only
This profile is educational reference material. It is not medical advice, not a prescription, and not an endorsement of self-administration. Compounds discussed here are research chemicals and most are not approved for human therapeutic use.