Exenatide
GLP-1 Receptor Agonist (Byetta/Bydureon)
aka Byetta · Bydureon · exendin-4 · AC2993
A GLP-1 receptor agonist derived from Gila monster peptide, researched for glycaemic control and weight reduction.
Sequence
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
Mechanism of action
Exenatide mimics the action of the incretin hormone GLP-1, which enhances glucose-dependent insulin secretion from the pancreas. It also slows gastric emptying, reduces appetite, and decreases glucagon secretion, which collectively help in controlling blood sugar levels.
What the evidence actually shows
There are numerous human clinical trials demonstrating the efficacy of exenatide in improving glycemic control and promoting weight loss in patients with type 2 diabetes. These studies consistently show significant reductions in HbA1c and body weight. However, long-term cardiovascular outcomes and effects on non-diabetic populations remain less explored.
Regulatory status
Exenatide is licensed in the UK for the treatment of type 2 diabetes as an adjunct to diet and exercise.
Source ↗Pharmacokinetics
Dosing — what backs each figure
Exenatide is an FDA-approved GLP-1 receptor agonist for type 2 diabetes with two distinct labelled regimens: BYETTA 5 mcg subcutaneously twice daily within 60 minutes before the morning and evening meals, escalating to 10 mcg twice daily after one month; and BYDUREON BCise 2 mg subcutaneously once weekly. It is chronic prescription therapy, not cycled, and the immediate-release form's pre-meal timing is part of the approved dosing, not optional.
BYETTA (immediate-release): 5 mcg subcutaneously twice daily, increased to 10 mcg twice daily after 1 month based on clinical response. Inject within 60 minutes before the morning and evening meals (>=6 h apart); never after a meal. Thigh, abdomen or upper arm, rotating sites
adults with type 2 diabetes mellitus, adjunct to diet and exercise · subcutaneous
FDA prescribing information, BYETTA (exenatide) injection, NDA 021773 ↗
BYDUREON BCise (extended-release): 2 mg subcutaneously once every 7 days, at any time of day, with or without meals; abdomen, thigh or upper arm
adults and paediatric patients aged 10 years and older with type 2 diabetes mellitus, adjunct to diet and exercise · subcutaneous
Handling and storage
FDA label section 16.2 Storage and Handling states verbatim: 'Do not freeze. Do not use BYETTA if it has been frozen.' and 'Protect BYETTA from light.' The in-use pen may be stored between 2 C and 25 C. Freeze-thaw is explicitly not tolerated.
Source ↗Safety
- ·Nausea
- ·Vomiting
- ·Diarrhea
- ·"Hypoglycemia (when used with sulfonylureas)"
- ·Pancreatitis
- ·"Renal impairment"
- ·"Severe allergic reactions"
- ·History of medullary thyroid carcinoma
- ·Multiple endocrine neoplasia syndrome type 2
- ·Severe renal impairment
- ·May delay absorption of orally administered drugs due to slowed gastric emptying
Nausea, injection-site nodules, hypoglycaemia with sulfonylureas
Reported combinations
- ·Metformin
- ·Dipeptidyl peptidase-4 inhibitors
Combination claims in this dataset are largely unsourced and should be treated as folk knowledge until a citation appears beside them.
References (4)
- Eng J, Kleinman WA, Singh L, Singh G, Raufman JP (1992) Isolation and characterization of exendin-4, an exendin-3 analogue, from Heloderma suspectum venom. Further evidence for an exendin receptor on dispersed acini from guinea pig pancreas ↗J Biol ChemPMID 1313797
Original isolation of the 39-amino-acid peptide exendin-4 from Heloderma suspectum venom; natural and synthetic exendin-4 stimulated a monophasic cAMP increase in dispersed guinea pig pancreatic acini beginning at 100 pM.
- Goke R, Fehmann HC, Linn T, et al. (1993) Exendin-4 is a high potency agonist and truncated exendin-(9-39)-amide an antagonist at the glucagon-like peptide 1-(7-36)-amide receptor of insulin-secreting beta-cells ↗J Biol ChemPMID 8396143
Established exendin-4 as a high-potency agonist at the GLP-1 receptor of insulin-secreting beta-cells, the pharmacological basis for its use in type 2 diabetes.
- Ahmann AJ, Capehorn M, Charpentier G, et al. (2018) Efficacy and Safety of Once-Weekly Semaglutide Versus Exenatide ER in Subjects With Type 2 Diabetes (SUSTAIN 3): A 56-Week, Open-Label, Randomized Clinical Trial ↗Diabetes CarePMID 29246950DOI
56-week open-label randomized phase III head-to-head trial of once-weekly semaglutide versus exenatide extended-release in type 2 diabetes.
- Tsapas A, Avgerinos I, Karagiannis T, et al. (2020) Comparative Effectiveness of Glucose-Lowering Drugs for Type 2 Diabetes: A Systematic Review and Network Meta-analysis ↗Ann Intern MedPMID 32598218DOI
Systematic review and network meta-analysis placing exenatide among the glucose-lowering drug classes for type 2 diabetes by comparative efficacy.
Data provenance
Chemistry and citations on this page were checked against primary sources on 2026-08-14. Values that could not be verified were left blank rather than filled with a plausible guess.