Metabolic & GLP-1PeptideEvidence A4 cited

Exenatide

GLP-1 Receptor Agonist (Byetta/Bydureon)

aka Byetta · Bydureon · exendin-4 · AC2993

A GLP-1 receptor agonist derived from Gila monster peptide, researched for glycaemic control and weight reduction.

Molecular wt
4186.6g/mol
Formula
C184H282N50O60S
CAS
141758-74-9
Half-life
2.4 h
established
Tmax
2 h

Sequence

One-letter39 residues

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Three-letter

H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2

Read this before quoting the sequence
39-amino-acid peptide amide (C-terminal Ser is amidated). Synthetic version of exendin-4, originally isolated from the venom of the Gila monster, Heloderma suspectum. Sequence taken verbatim from the FDA-approved BYETTA prescribing information, section 11 DESCRIPTION.
Source ↗

Mechanism of action

Exenatide mimics the action of the incretin hormone GLP-1, which enhances glucose-dependent insulin secretion from the pancreas. It also slows gastric emptying, reduces appetite, and decreases glucagon secretion, which collectively help in controlling blood sugar levels.

What the evidence actually shows

Grade A

There are numerous human clinical trials demonstrating the efficacy of exenatide in improving glycemic control and promoting weight loss in patients with type 2 diabetes. These studies consistently show significant reductions in HbA1c and body weight. However, long-term cardiovascular outcomes and effects on non-diabetic populations remain less explored.

Regulatory status

Status
Approved prescription medicine (US, EU and elsewhere), but several US presentations are now discontinued. Drugs@FDA records: BYETTA NDA 021773 (AstraZeneca AB), original approval 28 April 2005, marketing status 'Discontinued'; BYETTA NDA 021919 (Amylin), original approval 30 October 2009, marketing status 'Prescription'; BYDUREON and BYDUREON PEN NDA 022200, original approval 27 January 2012, marketing status 'Discontinued'; BYDUREON BCISE NDA 209210, original approval 20 October 2017, marketing status 'Discontinued'. A generic exenatide injection (ANDA 206697, Amneal) is listed as 'Prescription'.
Approved as
BYETTA (exenatide injection, twice daily) and BYDUREON / BYDUREON BCISE (exenatide extended-release, once weekly), for type 2 diabetes mellitus as an adjunct to diet and exercise.
Clinical stage
Approved and marketed (US immediate-release generic and Byetta NDA 021919); the extended-release Bydureon presentations are discontinued in the US per Drugs@FDA.
WADA
Not named on the WADA 2026 Prohibited List; no GLP-1 receptor agonist appears in the sections retrieved (S0, S2, S4). S0 does not apply because exenatide is an approved medicine.
UK
licensed

Exenatide is licensed in the UK for the treatment of type 2 diabetes as an adjunct to diet and exercise.

Source ↗

Pharmacokinetics

Half-life
2.4 h
Tmax
2 h
Absorption
subcutaneous
Elimination
renal
Washout
3 days
Titration
5mcg BID x4wk then 10mcg BID
Low-confidence pharmacokinetics
These figures are recorded as established rather than measured in a published PK study. Treat them as an order of magnitude. Anything downstream of them — accumulation, steady state, washout — inherits that uncertainty.

Dosing — what backs each figure

Exenatide is an FDA-approved GLP-1 receptor agonist for type 2 diabetes with two distinct labelled regimens: BYETTA 5 mcg subcutaneously twice daily within 60 minutes before the morning and evening meals, escalating to 10 mcg twice daily after one month; and BYDUREON BCise 2 mg subcutaneously once weekly. It is chronic prescription therapy, not cycled, and the immediate-release form's pre-meal timing is part of the approved dosing, not optional.

ClinicalApproved labelling or a published human trial

Handling and storage

Lyophilized
Not applicable - BYETTA is supplied as a sterile, preserved isotonic solution in a prefilled pen, not as a lyophilised powder.
Reconstituted
Store BYETTA in the refrigerator at 36 F to 46 F (2 C to 8 C). After first use, BYETTA can be kept at a temperature not to exceed 77 F (25 C). Discard the pen 30 days after first use, even if some drug remains in the pen.

FDA label section 16.2 Storage and Handling states verbatim: 'Do not freeze. Do not use BYETTA if it has been frozen.' and 'Protect BYETTA from light.' The in-use pen may be stored between 2 C and 25 C. Freeze-thaw is explicitly not tolerated.

Source ↗

Safety

Commonly reported
  • ·Nausea
  • ·Vomiting
  • ·Diarrhea
  • ·"Hypoglycemia (when used with sulfonylureas)"
Rarely reported
  • ·Pancreatitis
  • ·"Renal impairment"
  • ·"Severe allergic reactions"
Contraindications
  • ·History of medullary thyroid carcinoma
  • ·Multiple endocrine neoplasia syndrome type 2
  • ·Severe renal impairment
Drug interactions
  • ·May delay absorption of orally administered drugs due to slowed gastric emptying

Nausea, injection-site nodules, hypoglycaemia with sulfonylureas

Reported combinations

Reported as synergistic
  • ·Metformin
Reported as antagonistic
  • ·Dipeptidyl peptidase-4 inhibitors

Combination claims in this dataset are largely unsourced and should be treated as folk knowledge until a citation appears beside them.

References (4)

Data provenance

Chemistry and citations on this page were checked against primary sources on 2026-08-14. Values that could not be verified were left blank rather than filled with a plausible guess.

Research use only
This profile is educational reference material. It is not medical advice, not a prescription, and not an endorsement of self-administration. Compounds discussed here are research chemicals and most are not approved for human therapeutic use.