Mazdutide
aka IBI362 · LY3305677 · dual GLP-1/glucagon
Dual GLP-1/glucagon receptor agonist. Approved in China June 2025. Superior to semaglutide in Phase 3.
Sequence
HGQGTFTSDYSKYLDEKKAKEFVEWLLEGGPSSG
His-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Glu-Lys-Lys-Ala-Lys(N-epsilon-acyl)-Glu-Phe-Val-Glu-Trp-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-NH2
Mechanism of action
Dual GLP-1 and glucagon receptor agonist (oxyntomodulin analogue, IBI362/LY3305677). The GLP-1 arm lowers appetite and blood glucose; the glucagon arm raises energy expenditure and promotes hepatic fat reduction.
What the evidence actually shows
APPROVED China June 2025. Phase 3 DREAMS-3: -2.03% HbA1c vs -1.84% semaglutide.
Regulatory status
Dosing — what backs each figure
Mazdutide is a once-weekly subcutaneous GLP-1/glucagon dual receptor agonist with phase 3 dosing of 4 mg, 6 mg and 9 mg weekly, and it received NMPA approval in China in June 2025 for chronic weight management and in September 2025 for type 2 diabetes. It is not FDA- or EMA-approved.
Mazdutide 4 mg or 6 mg once weekly, or placebo, for 48 weeks (primary endpoints at 32 weeks). Mean percentage weight change at 32 weeks was -10.09% (4 mg) and -12.55% (6 mg); discontinuation for adverse events was 1.5% (4 mg) and 0.5% (6 mg) versus 1.0% placebo
Chinese adults with overweight or obesity plus at least one weight-related coexisting condition (phase 3, GLORY-1) · subcutaneous, once weekly
Mazdutide 9 mg once weekly versus placebo (GLORY-2), a double-blind, placebo-controlled phase 3 randomised clinical trial
Chinese adults with obesity (BMI >=30), with or without type 2 diabetes · subcutaneous, once weekly
Regulatory approval: in June 2025 mazdutide (Xinermei) received its first approval, in China, for long-term body weight management in adults with BMI >=28, or BMI >=24 with one or more weight-related comorbidity, in combination with diet control and increased physical activity. In September 2025 it was also approved in China for glycaemic control in adults with type 2 diabetes
Chinese adults with obesity/overweight, and separately adults with type 2 diabetes · subcutaneous, once weekly
Shirley M. Mazdutide: First Approval. Drugs. 2025;85(12):1621-1627 (China NMPA approval) ↗
Handling and storage
Safety
- ·Not established
- ·GLP-1/glucagon class effects
GI effects; transient heart-rate rise
References (3)
- Ji L, et al. (2025) Once-Weekly Mazdutide in Chinese Adults with Obesity or Overweight ↗The New England Journal of MedicinePMID 40421736DOI
GLORY-1 phase 3 double-blind placebo-controlled trial in China: adults with BMI at least 28, or 24 to under 28 with a weight-related condition, randomised 1:1:1 to mazdutide 4 mg, mazdutide 6 mg or placebo for 48 weeks.
- Ji L, et al. (2023) A phase 2 randomised controlled trial of mazdutide in Chinese overweight adults or adults with obesity ↗Nature CommunicationsPMID 38092790DOI
Phase 2 trial (NCT04904913) in 248 participants at 20 Chinese hospitals: mean body-weight change at week 24 was -6.7% with mazdutide 3 mg, -10.4% with 4.5 mg and -11.3% with 6 mg versus +1.0% with placebo.
- Shirley M (2025) Mazdutide: First Approval ↗DrugsPMID 41028652DOI
Records that mazdutide (Xinermei) received its first approval in China in June 2025 for long-term weight management in adults with BMI at least 28, or BMI 24 to under 28 with a weight-related comorbidity, and a second Chinese approval in September 2025 for glycaemic control in type 2 diabetes.
Data provenance
Chemistry and citations on this page were checked against primary sources on 2026-08-14. Values that could not be verified were left blank rather than filled with a plausible guess.
Could not verify
storage.lyophilized, storage.reconstituted, storage.lightSensitive, reconstitution.solvent