Metabolic & GLP-1Evidence A3 cited

Mazdutide

aka IBI362 · LY3305677 · dual GLP-1/glucagon

Dual GLP-1/glucagon receptor agonist. Approved in China June 2025. Superior to semaglutide in Phase 3.

Molecular wt
4563g/mol
Formula
C210H322N46O67
CAS
2259884-03-0

Sequence

One-letter34 residues

HGQGTFTSDYSKYLDEKKAKEFVEWLLEGGPSSG

Three-letter

His-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Glu-Lys-Lys-Ala-Lys(N-epsilon-acyl)-Glu-Phe-Val-Glu-Trp-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-NH2

Read this before quoting the sequence
34 residues. FDA GSRS MAZDUTIDE (UNII MB76Z4IBZ5) gives the subunit HGQGTFTSDYSKYLDEKKAKEFVEWLLEGGPSSG with a C-terminal glycinamide. Position 2 is 2-methylalanine (Aib), shown as G in the GSRS one-letter subunit; Lys20 carries the acyl chain N6-[(22S)-22,42-dicarboxy-10,19,24-trioxo-3,6,12,15-tetraoxa-9,18,23-triazadotetracontan-1-oyl]. This matches the WHO INN chemical name published in Recommended INN List 88 (WHO Drug Information Vol. 36, No. 3, 2022). Mazdutide is an oxyntomodulin analogue and a dual GLP-1/glucagon receptor agonist.
Source ↗

Mechanism of action

Dual GLP-1 and glucagon receptor agonist (oxyntomodulin analogue, IBI362/LY3305677). The GLP-1 arm lowers appetite and blood glucose; the glucagon arm raises energy expenditure and promotes hepatic fat reduction.

What the evidence actually shows

Grade A

APPROVED China June 2025. Phase 3 DREAMS-3: -2.03% HbA1c vs -1.84% semaglutide.

Regulatory status

Status
Approved in China only. First approval by China's NMPA in June 2025 for long-term body weight management (in combination with diet and increased physical activity) in adults with BMI at least 28 kg/m2, or BMI at least 24 kg/m2 with one or more weight-related comorbidity; a further Chinese approval followed in September 2025 for glycaemic control in adults with type 2 diabetes. Not approved by the FDA or EMA. Developed by Innovent Biologics with Eli Lilly.
Approved as
Xinermei (China, NMPA)
Clinical stage
Approved in China; phase 3 continuing in other indications and territories (e.g. NCT06931028 obstructive sleep apnoea, NCT06884293 versus semaglutide, NCT06184568 early type 2 diabetes).
WADA
Not named on the 2026 WADA Prohibited List; GLP-1 and glucagon receptor agonists do not appear in any section of that list.
Source ↗

Dosing — what backs each figure

Mazdutide is a once-weekly subcutaneous GLP-1/glucagon dual receptor agonist with phase 3 dosing of 4 mg, 6 mg and 9 mg weekly, and it received NMPA approval in China in June 2025 for chronic weight management and in September 2025 for type 2 diabetes. It is not FDA- or EMA-approved.

ClinicalApproved labelling or a published human trial

Handling and storage

No compound-specific stability data exists
Mazdutide is approved only in China (Xinermei). No English-language prescribing information was retrievable, and no storage specification is present in FDA, EMA or DailyMed sources. No storage figures are asserted here. General peptide handling still applies — reconstitute gently, keep it cold, keep it dark — but any specific figure you see quoted for this compound elsewhere is someone's assumption, not a measurement.

Safety

Contraindications
  • ·Not established
Drug interactions
  • ·GLP-1/glucagon class effects

GI effects; transient heart-rate rise

References (3)

Data provenance

Chemistry and citations on this page were checked against primary sources on 2026-08-14. Values that could not be verified were left blank rather than filled with a plausible guess.

Could not verify
storage.lyophilized, storage.reconstituted, storage.lightSensitive, reconstitution.solvent

Research use only
This profile is educational reference material. It is not medical advice, not a prescription, and not an endorsement of self-administration. Compounds discussed here are research chemicals and most are not approved for human therapeutic use.